SCOPe 2.08: Domain d3hmbb1: 3hmb B:1-154

Lineage for d3hmbb1 (3hmb B:1-154)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families)

5. Family d.118.1.0: automated matches [191348] (1 protein)
   not a true family

6. Protein automated matches [190280] (10 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [189356] (3 PDB entries)

8. Domain d3hmbb1: 3hmb B:1-154 [177693]
   Other proteins in same PDB: d3hmbb2
   automated match to d1yb0a1
   complexed with zn; mutant

Details for d3hmbb1

PDB Entry: 3hmb, 2.7 Å

PDB Description: mutant endolysin from bacillus subtilis

PDB Compounds: (B:) N-acetylmuramoyl-L-alanine amidase xlyA

SCOPe Domain Sequences for d3hmbb1:

Sequence; same for both SEQRES and ATOM records:

>d3hmbb1 d.118.1.0 (B:1-154) automated matches {Bacillus subtilis [TaxId: 1423]}
mvniiqkfipvgannrpgyamkpkyitvhntantavgadaaaharylknpdtttswhftv
ddkeiyqhlplnengwhagdgngsgnrasigieicenadgdfakatanaqwliktlmaeh
nislanvvphkywsgkecprklldkwdsfkagig

Timeline for d3hmbb1:

• d3hmbb1 first appeared in SCOPe 2.01, called d3hmbb_
  
• d3hmbb1 appears in SCOPe 2.07