Class a: All alpha proteins [46456] (289 folds) |
Fold a.47: STAT-like [47654] (6 superfamilies) 4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix |
Superfamily a.47.2: t-snare proteins [47661] (1 family) |
Family a.47.2.1: t-snare proteins [47662] (6 proteins) |
Protein Syntaxin 1A N-terminal domain [47663] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [47664] (3 PDB entries) |
Domain d1ez3b_: 1ez3 B: [17769] three-helical fragment; similar to one spectrin repeat |
PDB Entry: 1ez3 (more details), 1.9 Å
SCOPe Domain Sequences for d1ez3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ez3b_ a.47.2.1 (B:) Syntaxin 1A N-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} drfmdeffeqveeirgfidkiaenveevkrkhsailaspnpdektkeeleelmsdikkta nkvrsklksieqsieqeeglnrssadlrirktqhstlsrkfvevmseynatqsdyrerck griq
Timeline for d1ez3b_: