![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
![]() | Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) ![]() duplication: contains two structural repeats of 3-helical motif |
![]() | Family a.132.1.4: PqqC-like [101463] (2 proteins) Pfam PF05312 |
![]() | Protein Coenzyme PQQ synthesis protein C, PqqC [101464] (2 species) |
![]() | Species Klebsiella pneumoniae [TaxId:272620] [189325] (4 PDB entries) |
![]() | Domain d3hlxd1: 3hlx D:2-251 [177685] Other proteins in same PDB: d3hlxa2, d3hlxd2 automated match to d1otva_ complexed with cl, gol, pqq; mutant |
PDB Entry: 3hlx (more details), 1.3 Å
SCOPe Domain Sequences for d3hlxd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hlxd1 a.132.1.4 (D:2-251) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 272620]} litdtlspqafeealrakgdfyhihhpyhiamhngnatreqiqgwvanrfyyqttiplkd aaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpgv rfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfffrsrls qanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtd kaawhttrlv
Timeline for d3hlxd1: