Lineage for d3hlxa_ (3hlx A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1749970Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 1749971Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 1750185Family a.132.1.4: PqqC-like [101463] (2 protein domains)
    Pfam PF05312
  6. 1750186Protein Coenzyme PQQ synthesis protein C, PqqC [101464] (2 species)
  7. 1750187Species Klebsiella pneumoniae [TaxId:272620] [189325] (4 PDB entries)
  8. 1750188Domain d3hlxa_: 3hlx A: [177684]
    automated match to d1otva_
    complexed with cl, gol, pqq; mutant

Details for d3hlxa_

PDB Entry: 3hlx (more details), 1.3 Å

PDB Description: Crystal Structure of PqqC Active Site Mutant Y175F in Complex with PQQ
PDB Compounds: (A:) Pyrroloquinoline-quinone synthase

SCOPe Domain Sequences for d3hlxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hlxa_ a.132.1.4 (A:) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 272620]}
litdtlspqafeealrakgdfyhihhpyhiamhngnatreqiqgwvanrfyyqttiplkd
aaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpgv
rfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfffrsrls
qanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtd
kaawhttrlvlehh

SCOPe Domain Coordinates for d3hlxa_:

Click to download the PDB-style file with coordinates for d3hlxa_.
(The format of our PDB-style files is described here.)

Timeline for d3hlxa_: