SCOPe 2.01: Domain d3hlxa_: 3hlx A:

Lineage for d3hlxa_ (3hlx A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.4: PqqC-like [101463] (2 proteins)
   Pfam PF05312

6. Protein Coenzyme PQQ synthesis protein C, PqqC [101464] (2 species)

7. Species Klebsiella pneumoniae [TaxId:272620] [189325] (3 PDB entries)

8. Domain d3hlxa_: 3hlx A: [177684]
   automated match to d1otva_
   complexed with cl, gol, pqq; mutant

Details for d3hlxa_

PDB Entry: 3hlx, 1.3 Å

PDB Description: Crystal Structure of PqqC Active Site Mutant Y175F in Complex with PQQ

PDB Compounds: (A:) Pyrroloquinoline-quinone synthase

SCOPe Domain Sequences for d3hlxa_:

Sequence; same for both SEQRES and ATOM records:

>d3hlxa_ a.132.1.4 (A:) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 272620]}
litdtlspqafeealrakgdfyhihhpyhiamhngnatreqiqgwvanrfyyqttiplkd
aaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpgv
rfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfffrsrls
qanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtd
kaawhttrlvlehh

Timeline for d3hlxa_:

• d3hlxa_ is new in SCOPe 2.01-stable
  
• d3hlxa_ appears in SCOPe 2.02
  
• d3hlxa_ appears in the current release, SCOPe 2.08, called d3hlxa1