Lineage for d3hlxa1 (3hlx A:2-251)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732616Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2732617Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2732840Family a.132.1.4: PqqC-like [101463] (2 proteins)
    Pfam PF05312
  6. 2732841Protein Coenzyme PQQ synthesis protein C, PqqC [101464] (2 species)
  7. 2732842Species Klebsiella pneumoniae [TaxId:272620] [189325] (4 PDB entries)
  8. 2732843Domain d3hlxa1: 3hlx A:2-251 [177684]
    Other proteins in same PDB: d3hlxa2, d3hlxd2
    automated match to d1otva_
    complexed with cl, gol, pqq; mutant

Details for d3hlxa1

PDB Entry: 3hlx (more details), 1.3 Å

PDB Description: Crystal Structure of PqqC Active Site Mutant Y175F in Complex with PQQ
PDB Compounds: (A:) Pyrroloquinoline-quinone synthase

SCOPe Domain Sequences for d3hlxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hlxa1 a.132.1.4 (A:2-251) Coenzyme PQQ synthesis protein C, PqqC {Klebsiella pneumoniae [TaxId: 272620]}
litdtlspqafeealrakgdfyhihhpyhiamhngnatreqiqgwvanrfyyqttiplkd
aaimancpdaqtrrkwvqrildhdgshgedggieawlrlgeavglsrddllserhvlpgv
rfavdaylnfarracwqeaacssltelfapqihqsrldswpqhypwikeegyfffrsrls
qanrdvehglalakaycdsaekqnrmleilqfkldilwsmldamtmayalqrppyhtvtd
kaawhttrlv

SCOPe Domain Coordinates for d3hlxa1:

Click to download the PDB-style file with coordinates for d3hlxa1.
(The format of our PDB-style files is described here.)

Timeline for d3hlxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hlxa2