Lineage for d3hltc_ (3hlt C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490779Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2490780Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2491513Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2491514Protein automated matches [190447] (52 species)
    not a true protein
  7. 2491741Species Human (Homo sapiens) [TaxId:9606] [188990] (17 PDB entries)
  8. 2491754Domain d3hltc_: 3hlt C: [177681]
    Other proteins in same PDB: d3hlta2
    automated match to d1yv9a1
    complexed with cl, na, so4

Details for d3hltc_

PDB Entry: 3hlt (more details), 2.3 Å

PDB Description: the crystal structure of human haloacid dehalogenase-like hydrolase domain containing 2 (hdhd2)
PDB Compounds: (C:) hdhd2

SCOPe Domain Sequences for d3hltc_:

Sequence, based on SEQRES records: (download)

>d3hltc_ c.108.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alkavlvdlsgtlhiedaavpgaqealkrlrgasviirfvtnttkeskqdllerlrklef
disedeiftsltaarsllerkqvrpmllvddralpdfkgiqtsdpnavvmglapehfhyq
ilnqafrllldgapliaihkaryykrkdglalgpgpfvtaleyatdtkatvvgkpektff
lealrgtgcepeeavmigddcrddvggaqdvgmlgilvktgkyrasdeekinpppyltce
sfphavdhilqhll

Sequence, based on observed residues (ATOM records): (download)

>d3hltc_ c.108.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alkavlvdlsgtvpgaqealkrlviirfvtnttkeskqdllerlrklefdisedeiftsl
taarsllerkqvrpmllvddralpdfkgiqtsdpnavvmglapehfhyqilnqafrllld
gapliaihkaryykrkdglalgpgpfvtaleyatdtkatvvgkpektfflealrgtgcep
eeavmigddcrddvggaqdvgmlgilvktgkyrasdeekinpppyltcesfphavdhilq
hll

SCOPe Domain Coordinates for d3hltc_:

Click to download the PDB-style file with coordinates for d3hltc_.
(The format of our PDB-style files is described here.)

Timeline for d3hltc_: