![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
![]() | Protein automated matches [190447] (55 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188990] (19 PDB entries) |
![]() | Domain d3hltc_: 3hlt C: [177681] Other proteins in same PDB: d3hlta2 automated match to d1yv9a1 complexed with cl, na, so4 |
PDB Entry: 3hlt (more details), 2.3 Å
SCOPe Domain Sequences for d3hltc_:
Sequence, based on SEQRES records: (download)
>d3hltc_ c.108.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} alkavlvdlsgtlhiedaavpgaqealkrlrgasviirfvtnttkeskqdllerlrklef disedeiftsltaarsllerkqvrpmllvddralpdfkgiqtsdpnavvmglapehfhyq ilnqafrllldgapliaihkaryykrkdglalgpgpfvtaleyatdtkatvvgkpektff lealrgtgcepeeavmigddcrddvggaqdvgmlgilvktgkyrasdeekinpppyltce sfphavdhilqhll
>d3hltc_ c.108.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} alkavlvdlsgtvpgaqealkrlviirfvtnttkeskqdllerlrklefdisedeiftsl taarsllerkqvrpmllvddralpdfkgiqtsdpnavvmglapehfhyqilnqafrllld gapliaihkaryykrkdglalgpgpfvtaleyatdtkatvvgkpektfflealrgtgcep eeavmigddcrddvggaqdvgmlgilvktgkyrasdeekinpppyltcesfphavdhilq hll
Timeline for d3hltc_: