SCOPe 2.07: Domain d3hlta1: 3hlt A:5-259

Lineage for d3hlta1 (3hlt A:5-259)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (55 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188990] (18 PDB entries)

8. Domain d3hlta1: 3hlt A:5-259 [177680]
   Other proteins in same PDB: d3hlta2
   automated match to d1yv9a1
   complexed with cl, na, so4

Details for d3hlta1

PDB Entry: 3hlt, 2.3 Å

PDB Description: the crystal structure of human haloacid dehalogenase-like hydrolase domain containing 2 (hdhd2)

PDB Compounds: (A:) hdhd2

SCOPe Domain Sequences for d3hlta1:

Sequence; same for both SEQRES and ATOM records:

>d3hlta1 c.108.1.0 (A:5-259) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ralkavlvdlsgtlhiedaavpgaqealkrlrgasviirfvtnttkeskqdllerlrkle
fdisedeiftsltaarsllerkqvrpmllvddralpdfkgiqtsdpnavvmglapehfhy
qilnqafrllldgapliaihkaryykrkdglalgpgpfvtaleyatdtkatvvgkpektf
flealrgtgcepeeavmigddcrddvggaqdvgmlgilvktgkyrasdeekinpppyltc
esfphavdhilqhll

Timeline for d3hlta1:

• d3hlta1 first appeared in SCOPe 2.01, called d3hlta_
  
• d3hlta1 appears in SCOPe 2.06
  
• d3hlta1 appears in the current release, SCOPe 2.08