Lineage for d3hlta_ (3hlt A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1187611Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1187612Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1188163Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1188164Protein automated matches [190447] (25 species)
    not a true protein
  7. 1188211Species Human (Homo sapiens) [TaxId:9606] [188990] (2 PDB entries)
  8. 1188214Domain d3hlta_: 3hlt A: [177680]
    automated match to d1yv9a1
    complexed with cl, na, so4

Details for d3hlta_

PDB Entry: 3hlt (more details), 2.3 Å

PDB Description: the crystal structure of human haloacid dehalogenase-like hydrolase domain containing 2 (hdhd2)
PDB Compounds: (A:) hdhd2

SCOPe Domain Sequences for d3hlta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hlta_ c.108.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ralkavlvdlsgtlhiedaavpgaqealkrlrgasviirfvtnttkeskqdllerlrkle
fdisedeiftsltaarsllerkqvrpmllvddralpdfkgiqtsdpnavvmglapehfhy
qilnqafrllldgapliaihkaryykrkdglalgpgpfvtaleyatdtkatvvgkpektf
flealrgtgcepeeavmigddcrddvggaqdvgmlgilvktgkyrasdeekinpppyltc
esfphavdhilqhlla

SCOPe Domain Coordinates for d3hlta_:

Click to download the PDB-style file with coordinates for d3hlta_.
(The format of our PDB-style files is described here.)

Timeline for d3hlta_: