Lineage for d3hlta1 (3hlt A:5-259)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920500Species Human (Homo sapiens) [TaxId:9606] [188990] (19 PDB entries)
  8. 2920515Domain d3hlta1: 3hlt A:5-259 [177680]
    Other proteins in same PDB: d3hlta2
    automated match to d1yv9a1
    complexed with cl, na, so4

Details for d3hlta1

PDB Entry: 3hlt (more details), 2.3 Å

PDB Description: the crystal structure of human haloacid dehalogenase-like hydrolase domain containing 2 (hdhd2)
PDB Compounds: (A:) hdhd2

SCOPe Domain Sequences for d3hlta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hlta1 c.108.1.0 (A:5-259) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ralkavlvdlsgtlhiedaavpgaqealkrlrgasviirfvtnttkeskqdllerlrkle
fdisedeiftsltaarsllerkqvrpmllvddralpdfkgiqtsdpnavvmglapehfhy
qilnqafrllldgapliaihkaryykrkdglalgpgpfvtaleyatdtkatvvgkpektf
flealrgtgcepeeavmigddcrddvggaqdvgmlgilvktgkyrasdeekinpppyltc
esfphavdhilqhll

SCOPe Domain Coordinates for d3hlta1:

Click to download the PDB-style file with coordinates for d3hlta1.
(The format of our PDB-style files is described here.)

Timeline for d3hlta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hlta2
View in 3D
Domains from other chains:
(mouse over for more information)
d3hltc_