SCOPe 2.05: Domain d3hlpb_: 3hlp B:

Lineage for d3hlpb_ (3hlp B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)

6. Protein Carboxypeptidase A [53189] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53190] (34 PDB entries)

8. Domain d3hlpb_: 3hlp B: [177679]
   automated match to d1pytb_
   complexed with mpd, mrd, zn

Details for d3hlpb_

PDB Entry: 3hlp, 1.6 Å

PDB Description: carboxypeptidase a liganded to an organic small-molecule: conformational changes

PDB Compounds: (B:) Carboxypeptidase A1 (Pancreatic)

SCOPe Domain Sequences for d3hlpb_:

Sequence; same for both SEQRES and ATOM records:

>d3hlpb_ c.56.5.1 (B:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]}
stntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrpai
widlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafthsq
nrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksivdf
vkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsykygs
iittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvltime
htv

Timeline for d3hlpb_:

• d3hlpb_ first appeared in SCOPe 2.01
  
• d3hlpb_ appears in SCOPe 2.04
  
• d3hlpb_ appears in SCOPe 2.06
  
• d3hlpb_ appears in the current release, SCOPe 2.08