Class b: All beta proteins [48724] (178 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) |
Family b.68.6.1: SGL-like [63830] (4 proteins) |
Protein automated matches [190602] (2 species) not a true protein |
Species Squid (Loligo vulgaris) [TaxId:6622] [189000] (6 PDB entries) |
Domain d3hlib_: 3hli B: [177669] automated match to d1pjxa_ complexed with ca; mutant |
PDB Entry: 3hli (more details), 1.4 Å
SCOPe Domain Sequences for d3hlib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hlib_ b.68.6.1 (B:) automated matches {Squid (Loligo vulgaris) [TaxId: 6622]} ipvieplftkvtedipgaegpvfdkngdfyivapdvevngkpageilridlktgkktvic kpevngyggipagcqcdrdanqlfvadmrlgllvvqtdgtfeeiakkdsegrrmqgcndc afdyegnlwitapagevapadatasmqekfgsiycfttdgqmiqvdtafqfpngiavrhm ndgrpyqlivaemptkklwsydikgpakienkkvwghipgtheggadgmdfdednnllva nwgsshievfgpdggqpkmrircpfekpsnlhfkpqtktifvtehennavwkfewqrngk kqycetlkfgif
Timeline for d3hlib_: