SCOPe 2.06: Domain d3hlia_: 3hli A:

Lineage for d3hlia_ (3hli A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families)

5. Family b.68.6.1: SGL-like [63830] (4 proteins)

6. Protein automated matches [190602] (2 species)
   not a true protein

7. Species Squid (Loligo vulgaris) [TaxId:6622] [189000] (6 PDB entries)

8. Domain d3hlia_: 3hli A: [177668]
   automated match to d1pjxa_
   complexed with ca; mutant

Details for d3hlia_

PDB Entry: 3hli, 1.4 Å

PDB Description: diisopropyl fluorophosphatase (dfpase), active site mutants

PDB Compounds: (A:) Diisopropyl-fluorophosphatase

SCOPe Domain Sequences for d3hlia_:

Sequence; same for both SEQRES and ATOM records:

>d3hlia_ b.68.6.1 (A:) automated matches {Squid (Loligo vulgaris) [TaxId: 6622]}
eipvieplftkvtedipgaegpvfdkngdfyivapdvevngkpageilridlktgkktvi
ckpevngyggipagcqcdrdanqlfvadmrlgllvvqtdgtfeeiakkdsegrrmqgcnd
cafdyegnlwitapagevapadatasmqekfgsiycfttdgqmiqvdtafqfpngiavrh
mndgrpyqlivaemptkklwsydikgpakienkkvwghipgtheggadgmdfdednnllv
anwgsshievfgpdggqpkmrircpfekpsnlhfkpqtktifvtehennavwkfewqrng
kkqycetlkfgif

Timeline for d3hlia_:

• d3hlia_ first appeared in SCOPe 2.01
  
• d3hlia_ appears in SCOPe 2.05
  
• d3hlia_ appears in SCOPe 2.07
  
• d3hlia_ appears in the current release, SCOPe 2.08