Lineage for d3hlia_ (3hli A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1134683Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1135111Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (3 families) (S)
  5. 1135112Family b.68.6.1: SGL-like [63830] (4 proteins)
  6. 1135143Protein automated matches [190602] (2 species)
    not a true protein
  7. 1135144Species Squid (Loligo vulgaris) [TaxId:6622] [189000] (4 PDB entries)
  8. 1135146Domain d3hlia_: 3hli A: [177668]
    automated match to d1pjxa_
    complexed with ca; mutant

Details for d3hlia_

PDB Entry: 3hli (more details), 1.4 Å

PDB Description: diisopropyl fluorophosphatase (dfpase), active site mutants
PDB Compounds: (A:) Diisopropyl-fluorophosphatase

SCOPe Domain Sequences for d3hlia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hlia_ b.68.6.1 (A:) automated matches {Squid (Loligo vulgaris) [TaxId: 6622]}
eipvieplftkvtedipgaegpvfdkngdfyivapdvevngkpageilridlktgkktvi
ckpevngyggipagcqcdrdanqlfvadmrlgllvvqtdgtfeeiakkdsegrrmqgcnd
cafdyegnlwitapagevapadatasmqekfgsiycfttdgqmiqvdtafqfpngiavrh
mndgrpyqlivaemptkklwsydikgpakienkkvwghipgtheggadgmdfdednnllv
anwgsshievfgpdggqpkmrircpfekpsnlhfkpqtktifvtehennavwkfewqrng
kkqycetlkfgif

SCOPe Domain Coordinates for d3hlia_:

Click to download the PDB-style file with coordinates for d3hlia_.
(The format of our PDB-style files is described here.)

Timeline for d3hlia_: