SCOPe 2.07: Domain d3hlhb_: 3hlh B:

Lineage for d3hlhb_ (3hlh B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
   consists of six 4-stranded beta-sheet motifs; meander

4. Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families)

5. Family b.68.6.1: SGL-like [63830] (4 proteins)

6. Protein automated matches [190602] (2 species)
   not a true protein

7. Species Squid (Loligo vulgaris) [TaxId:6622] [189000] (6 PDB entries)

8. Domain d3hlhb_: 3hlh B: [177665]
   automated match to d1pjxa_
   complexed with ca; mutant

Details for d3hlhb_

PDB Entry: 3hlh, 1.8 Å

PDB Description: diisopropyl fluorophosphatase (dfpase), active site mutants

PDB Compounds: (B:) Diisopropyl-fluorophosphatase

SCOPe Domain Sequences for d3hlhb_:

Sequence; same for both SEQRES and ATOM records:

>d3hlhb_ b.68.6.1 (B:) automated matches {Squid (Loligo vulgaris) [TaxId: 6622]}
ipvieplftkvtedipgaegpvfdkngdfyivapavevngkpageilridlktgkktvic
kpevngyggipagcqcdrdanqlfvadmrlgllvvqtdgtfeeiakkdsegrrmqgcndc
afdyegnlwitapagevapadatasmqekfgsiycfttdgqmiqvdtafqfpngiavrhm
ndgrpyqlivaemptkklwsydikgpakienkkvwghipgtheggadgmdfdednnllva
nwgsshievfgpdggqpkmrircpfekpsnlhfkpqtktifvtehennavwkfewqrngk
kqycetlkfgif

Timeline for d3hlhb_:

• d3hlhb_ first appeared in SCOPe 2.01
  
• d3hlhb_ appears in SCOPe 2.06
  
• d3hlhb_ appears in the current release, SCOPe 2.08