Lineage for d3hlha_ (3hlh A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2808422Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) (S)
  5. 2808423Family b.68.6.1: SGL-like [63830] (4 proteins)
  6. 2808454Protein automated matches [190602] (2 species)
    not a true protein
  7. 2808455Species Squid (Loligo vulgaris) [TaxId:6622] [189000] (6 PDB entries)
  8. 2808461Domain d3hlha_: 3hlh A: [177664]
    automated match to d1pjxa_
    complexed with ca; mutant

Details for d3hlha_

PDB Entry: 3hlh (more details), 1.8 Å

PDB Description: diisopropyl fluorophosphatase (dfpase), active site mutants
PDB Compounds: (A:) Diisopropyl-fluorophosphatase

SCOPe Domain Sequences for d3hlha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hlha_ b.68.6.1 (A:) automated matches {Squid (Loligo vulgaris) [TaxId: 6622]}
ipvieplftkvtedipgaegpvfdkngdfyivapavevngkpageilridlktgkktvic
kpevngyggipagcqcdrdanqlfvadmrlgllvvqtdgtfeeiakkdsegrrmqgcndc
afdyegnlwitapagevapadatasmqekfgsiycfttdgqmiqvdtafqfpngiavrhm
ndgrpyqlivaemptkklwsydikgpakienkkvwghipgtheggadgmdfdednnllva
nwgsshievfgpdggqpkmrircpfekpsnlhfkpqtktifvtehennavwkfewqrngk
kqycetlkfgif

SCOPe Domain Coordinates for d3hlha_:

Click to download the PDB-style file with coordinates for d3hlha_.
(The format of our PDB-style files is described here.)

Timeline for d3hlha_: