Lineage for d1bf5a1 (1bf5 A:136-316)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000266Fold a.47: STAT-like [47654] (6 superfamilies)
    4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix
  4. 2000267Superfamily a.47.1: STAT [47655] (1 family) (S)
  5. 2000268Family a.47.1.1: STAT [47656] (3 proteins)
  6. 2000273Protein STAT-1, coiled coil domain [47657] (1 species)
  7. 2000274Species Human (Homo sapiens) [TaxId:9606] [47658] (1 PDB entry)
  8. 2000275Domain d1bf5a1: 1bf5 A:136-316 [17766]
    Other proteins in same PDB: d1bf5a2, d1bf5a3
    protein/DNA complex

Details for d1bf5a1

PDB Entry: 1bf5 (more details), 2.9 Å

PDB Description: tyrosine phosphorylated stat-1/dna complex
PDB Compounds: (A:) signal transducer and activator of transcription 1-alpha/beta

SCOPe Domain Sequences for d1bf5a1:

Sequence, based on SEQRES records: (download)

>d1bf5a1 a.47.1.1 (A:136-316) STAT-1, coiled coil domain {Human (Homo sapiens) [TaxId: 9606]}
ldkqkeldskvrnvkdkvmcieheiksledlqdeydfkcktlqnrehetngvaksdqkqe
qlllkkmylmldnkrkevvhkiiellnvteltqnalindelvewkrrqqsaciggppnac
ldqlqnwftivaeslqqvrqqlkkleeleqkytyehdpitknkqvlwdrtfslfqqliqs
s

Sequence, based on observed residues (ATOM records): (download)

>d1bf5a1 a.47.1.1 (A:136-316) STAT-1, coiled coil domain {Human (Homo sapiens) [TaxId: 9606]}
ldkqkeldskvrnvkdkvmcieheiksledlqdeydfkcktlqnrehlllkkmylmldnk
rkevvhkiiellnvteltqnalindelvewkrrqqsaciggppnacldqlqnwftivaes
lqqvrqqlkkleeleqkytyehdpitknkqvlwdrtfslfqqliqss

SCOPe Domain Coordinates for d1bf5a1:

Click to download the PDB-style file with coordinates for d1bf5a1.
(The format of our PDB-style files is described here.)

Timeline for d1bf5a1: