SCOPe 2.06: Domain d3hkab_: 3hka B:

Lineage for d3hkab_ (3hka B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.8: Uronate isomerase-like [75082] (2 proteins)
   contains all-alpha subdomain inserted after the first strand

6. Protein Uncharacterized protein BH0493 [159395] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [159396] (9 PDB entries)
   Uniprot Q9KFI6 1-423

8. Domain d3hkab_: 3hka B: [177651]
   automated match to d2pnka1
   complexed with cl, co3, fix, zn

Details for d3hkab_

PDB Entry: 3hka, 1.9 Å

PDB Description: Crystal structure of uronate isomerase from Bacillus halodurans complexed with zinc and D-Fructuronate

PDB Compounds: (B:) uronate isomerase

SCOPe Domain Sequences for d3hkab_:

Sequence; same for both SEQRES and ATOM records:

>d3hkab_ c.1.9.8 (B:) Uncharacterized protein BH0493 {Bacillus halodurans [TaxId: 86665]}
insrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwtdvs
ieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyfakk
tseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneyeqtk
hrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgriird
cllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvtmls
renqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvleql
iykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvg

Timeline for d3hkab_:

• d3hkab_ first appeared in SCOPe 2.01
  
• d3hkab_ appears in SCOPe 2.05
  
• d3hkab_ appears in SCOPe 2.07
  
• d3hkab_ appears in the current release, SCOPe 2.08