Lineage for d1brwb1 (1brw B:1001-1070)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000161Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 2000172Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) (S)
    automatically mapped to Pfam PF02885
  5. 2000173Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)
  6. 2000216Protein Pyrimidine nucleoside phosphorylase [47652] (1 species)
  7. 2000217Species Bacillus stearothermophilus [TaxId:1422] [47653] (1 PDB entry)
  8. 2000219Domain d1brwb1: 1brw B:1001-1070 [17765]
    Other proteins in same PDB: d1brwa2, d1brwa3, d1brwb2, d1brwb3
    complexed with ca, mes, po4, ura

Details for d1brwb1

PDB Entry: 1brw (more details), 2.1 Å

PDB Description: the crystal structure of pyrimidine nucleoside phosphorylase in a closed conformation
PDB Compounds: (B:) protein (pyrimidine nucleoside phosphorylase)

SCOPe Domain Sequences for d1brwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1brwb1 a.46.2.1 (B:1001-1070) Pyrimidine nucleoside phosphorylase {Bacillus stearothermophilus [TaxId: 1422]}
mrmvdliakkrdgkaltkeeiewivrgytngdipdyqmsalamaiyfrgmteeetaaltm
amvqsgemld

SCOPe Domain Coordinates for d1brwb1:

Click to download the PDB-style file with coordinates for d1brwb1.
(The format of our PDB-style files is described here.)

Timeline for d1brwb1: