Lineage for d1tpta1 (1tpt A:1-70)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327502Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 2327513Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) (S)
    automatically mapped to Pfam PF02885
  5. 2327514Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)
  6. 2327561Protein Thymidine phosphorylase [47650] (2 species)
  7. 2327562Species Escherichia coli [TaxId:562] [47651] (7 PDB entries)
  8. 2327570Domain d1tpta1: 1tpt A:1-70 [17763]
    Other proteins in same PDB: d1tpta2, d1tpta3
    complexed with so4, tdr

Details for d1tpta1

PDB Entry: 1tpt (more details), 2.8 Å

PDB Description: three-dimensional structure of thymidine phosphorylase from escherichia coli at 2.8 angstroms resolution
PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d1tpta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tpta1 a.46.2.1 (A:1-70) Thymidine phosphorylase {Escherichia coli [TaxId: 562]}
lflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
mamrdsgtvl

SCOPe Domain Coordinates for d1tpta1:

Click to download the PDB-style file with coordinates for d1tpta1.
(The format of our PDB-style files is described here.)

Timeline for d1tpta1: