SCOPe 2.07: Domain d1tpta1: 1tpt A:1-70

Lineage for d1tpta1 (1tpt A:1-70)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
   4 helices; bundle, left-handed twist; right-handed superhelix

4. Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families)
   automatically mapped to Pfam PF02885

5. Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)

6. Protein Thymidine phosphorylase [47650] (2 species)

7. Species Escherichia coli [TaxId:562] [47651] (7 PDB entries)

8. Domain d1tpta1: 1tpt A:1-70 [17763]
   Other proteins in same PDB: d1tpta2, d1tpta3
   complexed with so4, tdr

Details for d1tpta1

PDB Entry: 1tpt, 2.8 Å

PDB Description: three-dimensional structure of thymidine phosphorylase from escherichia coli at 2.8 angstroms resolution

PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d1tpta1:

Sequence; same for both SEQRES and ATOM records:

>d1tpta1 a.46.2.1 (A:1-70) Thymidine phosphorylase {Escherichia coli [TaxId: 562]}
lflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
mamrdsgtvl

Timeline for d1tpta1:

• d1tpta1 first appeared (with stable ids) in SCOP 1.55, called d1tpt_1
  
• d1tpta1 appears in SCOPe 2.06
  
• d1tpta1 appears in the current release, SCOPe 2.08