![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.46: Methionine synthase domain-like [47643] (2 superfamilies) 4 helices; bundle, left-handed twist; right-handed superhelix |
![]() | Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (1 family) ![]() |
![]() | Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins) |
![]() | Protein Thymidine phosphorylase [47650] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [47651] (4 PDB entries) |
![]() | Domain d1tpt_1: 1tpt 1-70 [17763] Other proteins in same PDB: d1tpt_2, d1tpt_3 complexed with so4, tdr |
PDB Entry: 1tpt (more details), 2.8 Å
SCOP Domain Sequences for d1tpt_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tpt_1 a.46.2.1 (1-70) Thymidine phosphorylase {Escherichia coli} lflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt mamrdsgtvl
Timeline for d1tpt_1: