Lineage for d3hk7d_ (3hk7 D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096081Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2096430Family c.1.9.8: Uronate isomerase-like [75082] (2 proteins)
    contains all-alpha subdomain inserted after the first strand
  6. 2096431Protein Uncharacterized protein BH0493 [159395] (1 species)
  7. 2096432Species Bacillus halodurans [TaxId:86665] [159396] (9 PDB entries)
    Uniprot Q9KFI6 1-423
  8. 2096489Domain d3hk7d_: 3hk7 D: [177627]
    automated match to d2pnka1
    complexed with cl, co3, na, rat, zn

Details for d3hk7d_

PDB Entry: 3hk7 (more details), 2.2 Å

PDB Description: Crystal structure of uronate isomerase from Bacillus halodurans complexed with zinc and D-Arabinarate, monoclinic crystal form
PDB Compounds: (D:) uronate isomerase

SCOPe Domain Sequences for d3hk7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hk7d_ c.1.9.8 (D:) Uncharacterized protein BH0493 {Bacillus halodurans [TaxId: 86665]}
sinsrevlaekvknavnnqpvtdmhthlfspnfgeillwdidelltyhylvaevmrwtdv
sieafwamskreqadliweelfikrspvseacrgvltclqglgldpatrdlqvyreyfak
ktseeqvdtvlqlanvsdvvmtndpfddneriswlegkqpdsrfhaalrldpllneyeqt
khrlrdwgykvndewnegsiqevkrfltdwiermdpvymavslpptfsfpeesnrgriir
dcllpvaekhnipfammigvkkrvhpalgdagdfvgkasmdgvehllreypnnkflvtml
srenqhelvvlarkfsnlmifgcwwfmnnpeiinemtrmrmemlgtsfipqhsdarvleq
liykwhhsksiiaevlidkyddilqagwevteeeikrdvadlfsrnfwrfvgr

SCOPe Domain Coordinates for d3hk7d_:

Click to download the PDB-style file with coordinates for d3hk7d_.
(The format of our PDB-style files is described here.)

Timeline for d3hk7d_: