Lineage for d3hjxa_ (3hjx A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1400466Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 1400467Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 1400468Family d.6.1.1: Prion-like [54099] (3 proteins)
  6. 1400529Protein automated matches [191016] (3 species)
    not a true protein
  7. 1400530Species Human (Homo sapiens) [TaxId:9606] [188783] (4 PDB entries)
  8. 1400532Domain d3hjxa_: 3hjx A: [177620]
    automated match to d1fkca_
    complexed with cd, cl

Details for d3hjxa_

PDB Entry: 3hjx (more details), 2 Å

PDB Description: human prion protein variant d178n with v129
PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d3hjxa_:

Sequence, based on SEQRES records: (download)

>d3hjxa_ d.6.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggyvlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhncvnitik
qhtvttttkgenftetdvkmmervveqmcitqyeresq

Sequence, based on observed residues (ATOM records): (download)

>d3hjxa_ d.6.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggyvlgsamsrpiihfgsdyedryyrenmhrypnqvyyrpmdeysnqnnfvhncvnitik
qhtvtttenftetdvkmmervveqmcitqyeresq

SCOPe Domain Coordinates for d3hjxa_:

Click to download the PDB-style file with coordinates for d3hjxa_.
(The format of our PDB-style files is described here.)

Timeline for d3hjxa_: