Lineage for d1azyb1 (1azy B:1-70)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 214199Fold a.46: Methionine synthase domain-like [47643] (2 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 214208Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (1 family) (S)
  5. 214209Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)
  6. 214227Protein Thymidine phosphorylase [47650] (1 species)
  7. 214228Species Escherichia coli [TaxId:562] [47651] (4 PDB entries)
  8. 214232Domain d1azyb1: 1azy B:1-70 [17762]
    Other proteins in same PDB: d1azya2, d1azya3, d1azyb2, d1azyb3

Details for d1azyb1

PDB Entry: 1azy (more details), 3 Å

PDB Description: structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase

SCOP Domain Sequences for d1azyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1azyb1 a.46.2.1 (B:1-70) Thymidine phosphorylase {Escherichia coli}
lflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
mamrdsgtvl

SCOP Domain Coordinates for d1azyb1:

Click to download the PDB-style file with coordinates for d1azyb1.
(The format of our PDB-style files is described here.)

Timeline for d1azyb1: