Lineage for d3hjpd_ (3hjp D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1855494Species Sulfolobus solfataricus [TaxId:2287] [188853] (4 PDB entries)
  8. 1855504Domain d3hjpd_: 3hjp D: [177618]
    automated match to d2cx3a1
    complexed with cl

Details for d3hjpd_

PDB Entry: 3hjp (more details), 2.55 Å

PDB Description: The crystal structure of Bcp4 from Sulfolobus Solfataricus
PDB Compounds: (D:) Peroxiredoxin, bacterioferritin comigratory protein homolog (Bcp-4)

SCOPe Domain Sequences for d3hjpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hjpd_ c.47.1.0 (D:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mveigekapeielvdtdlkkvkipsdfkgkvvvlafypaaftsvstkemstfrdsmakfn
evnavvigisvdppfsnkafkeqnkinftivsdfnreavkaygvagelpilkgyvlakrs
vfvidkngivrykwvsedptkepnydeikdvvtklsle

SCOPe Domain Coordinates for d3hjpd_:

Click to download the PDB-style file with coordinates for d3hjpd_.
(The format of our PDB-style files is described here.)

Timeline for d3hjpd_: