SCOPe 2.03: Domain d3hjpa_: 3hjp A:

Lineage for d3hjpa_ (3hjp A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [188853] (4 PDB entries)

8. Domain d3hjpa_: 3hjp A: [177615]
   automated match to d2cx3a1
   complexed with cl

Details for d3hjpa_

PDB Entry: 3hjp, 2.55 Å

PDB Description: The crystal structure of Bcp4 from Sulfolobus Solfataricus

PDB Compounds: (A:) Peroxiredoxin, bacterioferritin comigratory protein homolog (Bcp-4)

SCOPe Domain Sequences for d3hjpa_:

Sequence; same for both SEQRES and ATOM records:

>d3hjpa_ c.47.1.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mveigekapeielvdtdlkkvkipsdfkgkvvvlafypaaftsvstkemstfrdsmakfn
evnavvigisvdppfsnkafkeqnkinftivsdfnreavkaygvagelpilkgyvlakrs
vfvidkngivrykwvsedptkepnydeikdvvtklsle

Timeline for d3hjpa_:

• d3hjpa_ first appeared in SCOPe 2.01
  
• d3hjpa_ appears in SCOPe 2.02
  
• d3hjpa_ appears in SCOPe 2.04
  
• d3hjpa_ appears in the current release, SCOPe 2.08, called d3hjpa1