Lineage for d3hjjc_ (3hjj C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962569Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 962570Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 962820Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 962821Protein automated matches [190967] (6 species)
    not a true protein
  7. 962822Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188916] (2 PDB entries)
  8. 962825Domain d3hjjc_: 3hjj C: [177612]
    automated match to d1ocxa_
    complexed with acy, gol, so4

Details for d3hjjc_

PDB Entry: 3hjj (more details), 2.15 Å

PDB Description: crystal structure of maltose o-acetyltransferase from bacillus anthracis
PDB Compounds: (C:) maltose o-acetyltransferase

SCOPe Domain Sequences for d3hjjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hjjc_ b.81.1.0 (C:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mktekdkmlagemyiaddeelvadrveakrltrlyneavetgderrftllnqllgssadg
kaqinpdfrcdygynihvgksffanfncvildvcevrigdhcmfapgvhiytathplhpv
ernsgkeygkpvkignnvwvgggaiinpgvsigdnaviasgavvtkdvpnnvvvggnpak
viktie

SCOPe Domain Coordinates for d3hjjc_:

Click to download the PDB-style file with coordinates for d3hjjc_.
(The format of our PDB-style files is described here.)

Timeline for d3hjjc_: