![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
![]() | Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) ![]() superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
![]() | Family b.81.1.0: automated matches [191560] (1 protein) not a true family |
![]() | Protein automated matches [190967] (6 species) not a true protein |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188916] (2 PDB entries) |
![]() | Domain d3hjjc_: 3hjj C: [177612] automated match to d1ocxa_ complexed with acy, gol, so4 |
PDB Entry: 3hjj (more details), 2.15 Å
SCOPe Domain Sequences for d3hjjc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hjjc_ b.81.1.0 (C:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mktekdkmlagemyiaddeelvadrveakrltrlyneavetgderrftllnqllgssadg kaqinpdfrcdygynihvgksffanfncvildvcevrigdhcmfapgvhiytathplhpv ernsgkeygkpvkignnvwvgggaiinpgvsigdnaviasgavvtkdvpnnvvvggnpak viktie
Timeline for d3hjjc_: