SCOPe 2.02: Domain d3hijd_: 3hij D:

Lineage for d3hijd_ (3hij D:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (15 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [189130] (1 PDB entry)

8. Domain d3hijd_: 3hij D: [177606]
   automated match to d1xkya1
   complexed with gol, na

Details for d3hijd_

PDB Entry: 3hij, 2.15 Å

PDB Description: Crystal structure of dihydrodipicolinate synthase from Bacillus anthracis in complex with its substrate, pyruvate

PDB Compounds: (D:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3hijd_:

Sequence; same for both SEQRES and ATOM records:

>d3hijd_ c.1.10.1 (D:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
midfgtiatamvtpfdingnidfakttklvnylidngttaivvggttgesptltseekva
lyrhvvsvvdkrvpviagtgsnnthasidltkkatevgvdavmlvapyynkpsqegmyqh
fkaiaestplpvmlynvpgrsivqisvdtvvrlseienivaixdaggdvltmteiiekta
ddfavysgddgltlpamavgakgivsvashvignemqemiaafqagefkkaqklhqllvr
vtdslfmapsptpvktalqmvgldvgsvrlpllplteeervtlqsvmqsipr

Timeline for d3hijd_:

• d3hijd_ first appeared in SCOPe 2.01
  
• d3hijd_ appears in SCOPe 2.03
  
• d3hijd_ appears in the current release, SCOPe 2.08