Lineage for d3hida_ (3hid A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111791Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 protein domains)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2112083Protein automated matches [190304] (11 species)
    not a true protein
  7. 2112129Species Yersinia pestis [TaxId:214092] [188914] (1 PDB entry)
  8. 2112130Domain d3hida_: 3hid A: [177602]
    automated match to d1adea_
    complexed with pg6

Details for d3hida_

PDB Entry: 3hid (more details), 1.6 Å

PDB Description: crystal structure of adenylosuccinate synthetase from yersinia pestis co92
PDB Compounds: (A:) adenylosuccinate synthetase

SCOPe Domain Sequences for d3hida_:

Sequence, based on SEQRES records: (download)

>d3hida_ c.37.1.10 (A:) automated matches {Yersinia pestis [TaxId: 214092]}
mgknvvvlgtqwgdegkgkvvdllterakyvvryqgghnaghtlvingektvlhlipsgi
lrenvisiigngvvlapdalmkemteleargvpvrerlllseacplilpyhvaldnarek
argakaigttgrgigpayedkvarrglrvsdlfnketfaiklkeiveyhnfqlvhyykea
avdyqkvlddvlaiadiltamvvdvselldnarkqgelimfegaqgtlldidhgtypyvt
ssnttaggvatgsglgpryvdyvlgivkaystrvgagpfptelndetgeflrkqgneyga
ttgrsrrtgwldivavrravqinslsgfcmtkldvldglkevklcvgyrmpdgrevdttp
laaegwegiepiyetmpgwsettfgvkehsklpqaalnyiqrveeltgvpidiistgpdr
detmilrdpfda

Sequence, based on observed residues (ATOM records): (download)

>d3hida_ c.37.1.10 (A:) automated matches {Yersinia pestis [TaxId: 214092]}
mgknvvvlgtqwgdegkgkvvdllterakyvvryqgghnaghtlvingektvlhlipsgi
lrenvisiigngvvlapdalmkemteleargvpvrerlllseacplilpyhvaldnarek
argrgigpayedkvarrglrvsdlfnketfaiklkeiveyhnfqlvhyykeaavdyqkvl
ddvlaiadiltamvvdvselldnarkqgelimfegaqgtlldidhgtypyvtssnttagg
vatgsglgpryvdyvlgivkaystrvgagpfptelndetgeflrkqgneygattgrsrrt
gwldivavrravqinslsgfcmtkldvldglkevklcvgyrmpdgrevdttplaaegweg
iepiyetmpgwsettfgvkehsklpqaalnyiqrveeltgvpidiistgpdrdetmilrd
pfda

SCOPe Domain Coordinates for d3hida_:

Click to download the PDB-style file with coordinates for d3hida_.
(The format of our PDB-style files is described here.)

Timeline for d3hida_: