Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (6 families) |
Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins) |
Protein automated matches [190060] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186779] (10 PDB entries) |
Domain d3hi6b_: 3hi6 B: [177601] Other proteins in same PDB: d3hi6l1, d3hi6l2, d3hi6y1, d3hi6y2 automated match to d1cqpa_ complexed with mn, so4 |
PDB Entry: 3hi6 (more details), 2.3 Å
SCOPe Domain Sequences for d3hi6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hi6b_ c.62.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gnvdlvflfdgsmslqpdefqkildfmkdvmkkcsntsyqfaavqfstsyktefdfsdyv kwkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlctelqkkiy
Timeline for d3hi6b_: