Lineage for d1otpa1 (1otp A:2-70)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327502Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 2327513Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) (S)
    automatically mapped to Pfam PF02885
  5. 2327514Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)
  6. 2327561Protein Thymidine phosphorylase [47650] (2 species)
  7. 2327562Species Escherichia coli [TaxId:562] [47651] (7 PDB entries)
  8. 2327567Domain d1otpa1: 1otp A:2-70 [17760]
    Other proteins in same PDB: d1otpa2, d1otpa3, d1otpa4

Details for d1otpa1

PDB Entry: 1otp (more details), 2.8 Å

PDB Description: structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase
PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d1otpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1otpa1 a.46.2.1 (A:2-70) Thymidine phosphorylase {Escherichia coli [TaxId: 562]}
flaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervsltm
amrdsgtvl

SCOPe Domain Coordinates for d1otpa1:

Click to download the PDB-style file with coordinates for d1otpa1.
(The format of our PDB-style files is described here.)

Timeline for d1otpa1: