| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies) 4 helices; bundle, left-handed twist; right-handed superhelix |
Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) ![]() automatically mapped to Pfam PF02885 |
| Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins) |
| Protein Thymidine phosphorylase [47650] (2 species) |
| Species Escherichia coli [TaxId:562] [47651] (7 PDB entries) |
| Domain d1otpa1: 1otp A:2-70 [17760] Other proteins in same PDB: d1otpa2, d1otpa3, d1otpa4 |
PDB Entry: 1otp (more details), 2.8 Å
SCOPe Domain Sequences for d1otpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1otpa1 a.46.2.1 (A:2-70) Thymidine phosphorylase {Escherichia coli [TaxId: 562]}
flaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervsltm
amrdsgtvl
Timeline for d1otpa1: