Lineage for d3hi1j_ (3hi1 J:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2560277Fold d.172: gp120 core [56501] (1 superfamily)
    unusual fold
  4. 2560278Superfamily d.172.1: gp120 core [56502] (1 family) (S)
  5. 2560279Family d.172.1.1: gp120 core [56503] (2 proteins)
  6. 2560280Protein gp120 core [56504] (3 species)
  7. 2560283Species Human immunodeficiency virus type 1 [TaxId:11676] [56505] (18 PDB entries)
  8. 2560301Domain d3hi1j_: 3hi1 J: [177593]
    Other proteins in same PDB: d3hi1a1, d3hi1a2, d3hi1l1, d3hi1l2
    automated match to d1g9ng_
    complexed with nag

Details for d3hi1j_

PDB Entry: 3hi1 (more details), 2.9 Å

PDB Description: structure of hiv-1 gp120 (core with v3) in complex with cd4-binding- site antibody f105
PDB Compounds: (J:) Glycoprotein 120

SCOPe Domain Sequences for d3hi1j_:

Sequence, based on SEQRES records: (download)

>d3hi1j_ d.172.1.1 (J:) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
tenfnmwknnmveqmhediislwdqslkpcvkltggsvitqacpkvsfepipihycapag
failkcndkkfngtgpctnvstvqcthgirpvvstqlllngslaeeeivirsenftnnak
tiivqlnesvvinctrpnnntrksinigpgralyttgeiigdirqahcnlsktqwentle
qiaiklkeqfgnnktiifnpssggdpeivthsfncggeffycnstqlftwndtrklnntg
rnitlpcrikqiinmwqevgkamyappirgqircssnitgllltrdggkdtngteifrpg
ggdmrdnwrselykykvvkie

Sequence, based on observed residues (ATOM records): (download)

>d3hi1j_ d.172.1.1 (J:) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
tenfnmwknnmveqmhediislwdqslkpcvkltggsvitqacpkvsfepipihycapag
failkcndkkfngtgpctnvstvqcthgirpvvstqlllngslaeeeivirsenftnnak
tiivqlnesvvinctrpnnrqahcnlsktqwentleqiaiklkeqfgnnktiifnpssgg
dpeivthsfncggeffycnstqlftwndrnitlpcrikqiinmwqevgkamyappirgqi
rcssnitgllltrdggkdtngteifrpgggdmrdnwrselykykvvkie

SCOPe Domain Coordinates for d3hi1j_:

Click to download the PDB-style file with coordinates for d3hi1j_.
(The format of our PDB-style files is described here.)

Timeline for d3hi1j_: