Lineage for d3hi1g_ (3hi1 G:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1683292Fold d.172: gp120 core [56501] (1 superfamily)
    unusual fold
  4. 1683293Superfamily d.172.1: gp120 core [56502] (1 family) (S)
  5. 1683294Family d.172.1.1: gp120 core [56503] (2 proteins)
  6. 1683295Protein gp120 core [56504] (2 species)
  7. 1683296Species Human immunodeficiency virus type 1 [TaxId:11676] [56505] (18 PDB entries)
  8. 1683312Domain d3hi1g_: 3hi1 G: [177592]
    Other proteins in same PDB: d3hi1a1, d3hi1a2, d3hi1l1, d3hi1l2
    automated match to d1g9ng_
    complexed with nag

Details for d3hi1g_

PDB Entry: 3hi1 (more details), 2.9 Å

PDB Description: structure of hiv-1 gp120 (core with v3) in complex with cd4-binding- site antibody f105
PDB Compounds: (G:) Glycoprotein 120

SCOPe Domain Sequences for d3hi1g_:

Sequence, based on SEQRES records: (download)

>d3hi1g_ d.172.1.1 (G:) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
tenfnmwknnmveqmhediislwdqslkpcvkltggsvitqacpkvsfepipihycapag
failkcndkkfngtgpctnvstvqcthgirpvvstqlllngslaeeeivirsenftnnak
tiivqlnesvvinctrpnnntrksinigpgralyttgeiigdirqahcnlsktqwentle
qiaiklkeqfgnnktiifnpssggdpeivthsfncggeffycnstqlftwndtrklnntg
rnitlpcrikqiinmwqevgkamyappirgqircssnitgllltrdggkdtngteifrpg
ggdmrdnwrselykykvvkie

Sequence, based on observed residues (ATOM records): (download)

>d3hi1g_ d.172.1.1 (G:) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
tenfnmwknnmveqmhediislwdqslkpcvkltggsvitqacpkvsfepipihycapag
failkcndkkfngtgpctnvstvqcthgirpvvstqlllngslaeeeivirsenftnnak
tiivqlnesvvinctrpnnrqahcnlsktqwentleqiaiklkeqfgnnktiifnpssgg
dpeivthsfncggeffycnstqlftwndrnitlpcrikqiinmwqevgkamyappirgqi
rcssnitgllltrdggkdtngteifrpgggdmrdnwrselykykvvkie

SCOPe Domain Coordinates for d3hi1g_:

Click to download the PDB-style file with coordinates for d3hi1g_.
(The format of our PDB-style files is described here.)

Timeline for d3hi1g_: