Lineage for d2tpt_1 (2tpt 1-70)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.46: Methionine synthase domain-like [47643] (2 superfamilies) Superfamily a.46.2: Pyrimidine nucleoside phosphorylase N-terminal domain [47648] (1 family) 
Family a.46.2.1: Pyrimidine nucleoside phosphorylase N-terminal domain [47649] (2 proteins) 
Protein Thymidine phosphorylase [47650] (1 species) Species Escherichia coli [TaxId:562] [47651] (4 PDB entries) 
Domain d2tpt_1: 2tpt 1-70 [17759]
Other proteins in same PDB: d2tpt_2, d2tpt_3
Details for d2tpt_1
PDB Entry: 2tpt (more details), 2.6 Å
PDB Description: structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase
SCOP Domain Sequences for d2tpt_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tpt_1 a.46.2.1 (1-70) Thymidine phosphorylase {Escherichia coli}
lflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
mamrdsgtvl
SCOP Domain Coordinates for d2tpt_1:
Click to download the PDB-style file with coordinates for d2tpt_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2tpt_1:
- d2tpt_1 first appeared (with stable ids) in SCOP 1.55
- d2tpt_1 appears in SCOP 1.59
- d2tpt_1 appears in the current release, SCOPe 2.08, called d2tpta1
View in 3D
