Lineage for d2tpta1 (2tpt A:2-70)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714352Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 2714363Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) (S)
    automatically mapped to Pfam PF02885
  5. 2714364Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)
  6. 2714411Protein Thymidine phosphorylase [47650] (2 species)
  7. 2714412Species Escherichia coli [TaxId:562] [47651] (7 PDB entries)
  8. 2714416Domain d2tpta1: 2tpt A:2-70 [17759]
    Other proteins in same PDB: d2tpta2, d2tpta3, d2tpta4
    complexed with so4

Details for d2tpta1

PDB Entry: 2tpt (more details), 2.6 Å

PDB Description: structural and theoretical studies suggest domain movement produces an active conformation of thymidine phosphorylase
PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d2tpta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2tpta1 a.46.2.1 (A:2-70) Thymidine phosphorylase {Escherichia coli [TaxId: 562]}
flaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervsltm
amrdsgtvl

SCOPe Domain Coordinates for d2tpta1:

Click to download the PDB-style file with coordinates for d2tpta1.
(The format of our PDB-style files is described here.)

Timeline for d2tpta1: