![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.260: Rhabdovirus nucleoprotein-like [140808] (1 superfamily) multihelical, consist of two helical domains; each domain contains a buried helix |
![]() | Superfamily a.260.1: Rhabdovirus nucleoprotein-like [140809] (1 family) ![]() automatically mapped to Pfam PF00945 |
![]() | Family a.260.1.1: Rhabdovirus nucleocapsid protein [140810] (2 proteins) Pfam PF00945; RNA-binding homooligomeric protein |
![]() | Protein automated matches [191075] (1 species) not a true protein |
![]() | Species Vesicular stomatitis indiana virus [TaxId:11277] [188986] (1 PDB entry) |
![]() | Domain d3hhwm_: 3hhw M: [177589] automated match to d2gica1 protein/RNA complex; complexed with tar |
PDB Entry: 3hhw (more details), 2.7 Å
SCOPe Domain Sequences for d3hhwm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hhwm_ a.260.1.1 (M:) automated matches {Vesicular stomatitis indiana virus [TaxId: 11277]} svtvkriidntvivpklpanedpveypadyfrkskeiplyinttkslsdlrgyvyqglks gnvsiihvnsylygalkdirgkldkdwssfginigkagdtigifdlvslkaldgvlpdgv sdasrtsaddkwlplyllglyrvgrtqmpeyrkklmdgltnqckmineqfeplvpegrdi fdvwgndsnytkivaavdmffhmfkkhecasfrygtivsrfkdcaalatfghlckitgms tedvttwilnrevademvqmmlpgqeidkadsympylidfglsskspywsvknpafhfwg qltalllrstrarnarqpddieytslttagllyayavgssadlaqqfcvgdnkytpddst gglttnappqgrdvvewlgwfedqnrkptpdmmqyakravmslqglrektigkyaksefd k
Timeline for d3hhwm_:
![]() Domains from other chains: (mouse over for more information) d3hhwk_, d3hhwl_, d3hhwn_, d3hhwo_ |