Lineage for d3hhva_ (3hhv A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880360Species Sulfolobus solfataricus [TaxId:2287] [188853] (4 PDB entries)
  8. 2880364Domain d3hhva_: 3hhv A: [177586]
    automated match to d1fb0a_

Details for d3hhva_

PDB Entry: 3hhv (more details), 1.83 Å

PDB Description: The crystal structure of the Thioredoxin A2 from Sulfolobus solfataricus
PDB Compounds: (A:) Thioredoxin (TrxA-2)

SCOPe Domain Sequences for d3hhva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hhva_ c.47.1.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
pvkhlnsknfdefitknkivvvdfwaewcapclilapvieelandypqvafgklnteesq
diamrygimslptimffkngelvdqilgavpreeievrlksll

SCOPe Domain Coordinates for d3hhva_:

Click to download the PDB-style file with coordinates for d3hhva_.
(The format of our PDB-style files is described here.)

Timeline for d3hhva_: