Lineage for d3hhtb_ (3hht B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783741Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2783802Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins)
    contains irregular array of helices in the N-terminal extension
    automatically mapped to Pfam PF02211
  6. 2783846Protein automated matches [190606] (3 species)
    not a true protein
  7. 2783849Species Geobacillus pallidus [TaxId:33936] [188988] (1 PDB entry)
  8. 2783850Domain d3hhtb_: 3hht B: [177583]
    Other proteins in same PDB: d3hhta_
    automated match to d1v29b_
    complexed with 3co, cl; mutant

Details for d3hhtb_

PDB Entry: 3hht (more details), 1.16 Å

PDB Description: a mutant of the nitrile hydratase from geobacillus pallidus having enhanced thermostability
PDB Compounds: (B:) Nitrile hydratase beta subunit

SCOPe Domain Sequences for d3hhtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hhtb_ b.34.4.4 (B:) automated matches {Geobacillus pallidus [TaxId: 33936]}
mngihdvggmdgfgkvmyvkeeediyfthdwerlalglvagcmaqglgmkafdefrigie
lmrpvdyltssyyghwiatvaynlvdtgvldekeldertevfskkpdtkiprredpalvk
lvekalndglsplreisasprfkvgeriktknihptghtrfpryardkygvidevygahv
fpddaahrkgenpqylyrvrfeaeelwgykqkdsvyidlwesymepv

SCOPe Domain Coordinates for d3hhtb_:

Click to download the PDB-style file with coordinates for d3hhtb_.
(The format of our PDB-style files is described here.)

Timeline for d3hhtb_: