Lineage for d3hhta_ (3hht A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224127Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 2224128Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) (S)
    duplication: contains two structural repeats
  5. 2224129Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
    automatically mapped to Pfam PF02979
  6. 2224149Protein automated matches [190256] (6 species)
    not a true protein
  7. 2224154Species Geobacillus pallidus [TaxId:33936] [188987] (1 PDB entry)
  8. 2224155Domain d3hhta_: 3hht A: [177582]
    Other proteins in same PDB: d3hhtb_
    automated match to d1v29a_
    complexed with 3co, cl; mutant

Details for d3hhta_

PDB Entry: 3hht (more details), 1.16 Å

PDB Description: A mutant of the nitrile hydratase from Geobacillus pallidus having enhanced thermostability
PDB Compounds: (A:) Nitrile hydratase alpha subunit

SCOPe Domain Sequences for d3hhta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hhta_ d.149.1.1 (A:) automated matches {Geobacillus pallidus [TaxId: 33936]}
idprfphhhprpqsfwearakaleslliekghlssdaiervikhyehelgpmngakvvak
awtdpafkqrlledsetvlrelgyyglqgehirvventdtvhnvvvctlcscypwpllgl
ppswykepayrarvvkeprqvlkefgldlpdsveirvwdssseirfmvlpqrpegtegmt
eeelaklvtrdsmigvakiepp

SCOPe Domain Coordinates for d3hhta_:

Click to download the PDB-style file with coordinates for d3hhta_.
(The format of our PDB-style files is described here.)

Timeline for d3hhta_: