Class a: All alpha proteins [46456] (285 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (52 species) not a true protein |
Species Enterococcus faecalis [TaxId:1351] [188913] (1 PDB entry) |
Domain d3hhha_: 3hhh A: [177574] automated match to d1xmab_ complexed with gol, so4 |
PDB Entry: 3hhh (more details), 2.7 Å
SCOPe Domain Sequences for d3hhha_:
Sequence, based on SEQRES records: (download)
>d3hhha_ a.4.5.0 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]} kqtellkgileglvlaiiqrketygyeitkilndqgfteivegtvytillrleknqwvia ekkpsekgpmrkfyrltssgeaeladfwqrwtllskqvnkmkkn
>d3hhha_ a.4.5.0 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]} kqtellkgileglvlaiiqrketygyeitkilndqgfteivegtvytillrleknqwvia ekkpsepmrkfyrltssgeaeladfwqrwtllskqvnkmkkn
Timeline for d3hhha_: