Lineage for d3hhha_ (3hhh A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694701Species Enterococcus faecalis [TaxId:1351] [188913] (1 PDB entry)
  8. 2694702Domain d3hhha_: 3hhh A: [177574]
    automated match to d1xmab_
    complexed with gol, so4

Details for d3hhha_

PDB Entry: 3hhh (more details), 2.7 Å

PDB Description: Crystal structure of transcriptional regulator, a member of PadR family, from Enterococcus faecalis V583
PDB Compounds: (A:) Transcriptional regulator, PadR family

SCOPe Domain Sequences for d3hhha_:

Sequence, based on SEQRES records: (download)

>d3hhha_ a.4.5.0 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]}
kqtellkgileglvlaiiqrketygyeitkilndqgfteivegtvytillrleknqwvia
ekkpsekgpmrkfyrltssgeaeladfwqrwtllskqvnkmkkn

Sequence, based on observed residues (ATOM records): (download)

>d3hhha_ a.4.5.0 (A:) automated matches {Enterococcus faecalis [TaxId: 1351]}
kqtellkgileglvlaiiqrketygyeitkilndqgfteivegtvytillrleknqwvia
ekkpsepmrkfyrltssgeaeladfwqrwtllskqvnkmkkn

SCOPe Domain Coordinates for d3hhha_:

Click to download the PDB-style file with coordinates for d3hhha_.
(The format of our PDB-style files is described here.)

Timeline for d3hhha_: