SCOPe 2.06: Domain d3hh8a_: 3hh8 A:

Lineage for d3hh8a_ (3hh8 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.2: TroA-like [53811] (6 proteins)

6. Protein automated matches [191053] (5 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:301447] [188912] (1 PDB entry)

8. Domain d3hh8a_: 3hh8 A: [177573]
   automated match to d1psza_
   complexed with fe

Details for d3hh8a_

PDB Entry: 3hh8, 1.87 Å

PDB Description: crystal structure and metal binding properties of the lipoprotein mtsa

PDB Compounds: (A:) Metal ABC transporter substrate-binding lipoprotein

SCOPe Domain Sequences for d3hh8a_:

Sequence; same for both SEQRES and ATOM records:

>d3hh8a_ c.92.2.2 (A:) automated matches {Streptococcus pyogenes [TaxId: 301447]}
sdklkvvatnsiiadmtkaiagdkidlhsivpigqdpheyeplpedaektsnadvifyng
inledggqawftklvknaqktknkdyfavsdgidviylegasekgkedphawlnlengii
yskniakqliakdpknketyeknlkayvaklekldkeakskfdaiaenkklivtsegcfk
yfskaygvpsayiweinteeegtpdqisslieklkvikpsalfvessvdrrpmetvskds
gipiyseiftdsiakkgkpgdsyyammkwnldkiseglak

Timeline for d3hh8a_:

• d3hh8a_ first appeared in SCOPe 2.01
  
• d3hh8a_ appears in SCOPe 2.05
  
• d3hh8a_ appears in SCOPe 2.07
  
• d3hh8a_ appears in the current release, SCOPe 2.08