SCOPe 2.08: Domain d1bmta1: 1bmt A:651-740

Lineage for d1bmta1 (1bmt A:651-740)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
   4 helices; bundle, left-handed twist; right-handed superhelix

4. Superfamily a.46.1: Methionine synthase domain [47644] (1 family)
   automatically mapped to Pfam PF02607

5. Family a.46.1.1: Methionine synthase domain [47645] (1 protein)

6. Protein Methionine synthase domain [47646] (1 species)

7. Species Escherichia coli [TaxId:562] [47647] (5 PDB entries)

8. Domain d1bmta1: 1bmt A:651-740 [17757]
   Other proteins in same PDB: d1bmta2, d1bmtb2
   complexed with cob

Details for d1bmta1

PDB Entry: 1bmt, 3 Å

PDB Description: how a protein binds b12: a 3.o angstrom x-ray structure of the b12- binding domains of methionine synthase

PDB Compounds: (A:) methionine synthase

SCOPe Domain Sequences for d1bmta1:

Sequence; same for both SEQRES and ATOM records:

>d1bmta1 a.46.1.1 (A:651-740) Methionine synthase domain {Escherichia coli [TaxId: 562]}
qaewrswevnkrleyslvkgitefieqdteearqqatrpieviegplmdgmnvvgdlfge
gkmflpqvvksarvmkqavaylepfieask

Timeline for d1bmta1:

• d1bmta1 first appeared (with stable ids) in SCOP 1.55
  
• d1bmta1 appears in SCOPe 2.07