SCOPe 2.06: Domain d3hh2b_: 3hh2 B:

Lineage for d3hh2b_ (3hh2 B:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.0: automated matches [191392] (1 protein)
   not a true family

6. Protein automated matches [190506] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188989] (6 PDB entries)

8. Domain d3hh2b_: 3hh2 B: [177566]
   automated match to d1s4yb_
   complexed with cit, po4

Details for d3hh2b_

PDB Entry: 3hh2, 2.15 Å

PDB Description: crystal structure of the myostatin:follistatin 288 complex

PDB Compounds: (B:) Growth/differentiation factor 8

SCOPe Domain Sequences for d3hh2b_:

Sequence; same for both SEQRES and ATOM records:

>d3hh2b_ g.17.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dfgldcdehstesrccrypltvdfeafgwdwiiapkrykanycsgecefvflqkyphthl
vhqanprgsagpcctptkmspinmlyfngkeqiiygkipamvvdrcgcs

Timeline for d3hh2b_:

• d3hh2b_ first appeared in SCOPe 2.01
  
• d3hh2b_ appears in SCOPe 2.05
  
• d3hh2b_ appears in SCOPe 2.07
  
• d3hh2b_ appears in the current release, SCOPe 2.08