![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
![]() | Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) ![]() |
![]() | Family g.17.1.0: automated matches [191392] (1 protein) not a true family |
![]() | Protein automated matches [190506] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188989] (2 PDB entries) |
![]() | Domain d3hh2a_: 3hh2 A: [177565] automated match to d1s4yb_ complexed with cit, po4 |
PDB Entry: 3hh2 (more details), 2.15 Å
SCOPe Domain Sequences for d3hh2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hh2a_ g.17.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dfgldcdehstesrccrypltvdfeafgwdwiiapkrykanycsgecefvflqkyphthl vhqanprgsagpcctptkmspinmlyfngkeqiiygkipamvvdrcgcs
Timeline for d3hh2a_: