Lineage for d3hgxb_ (3hgx B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 924951Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 924952Superfamily a.130.1: Chorismate mutase II [48600] (4 families) (S)
  5. 924953Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins)
    intertwined homodimer of 3-helical subunits
  6. 924973Protein automated matches [191058] (1 species)
    not a true protein
  7. 924974Species Pseudomonas aeruginosa [TaxId:287] [188941] (4 PDB entries)
  8. 924984Domain d3hgxb_: 3hgx B: [177564]
    automated match to d2h9ca1
    complexed with pyr, sal; mutant

Details for d3hgxb_

PDB Entry: 3hgx (more details), 2.5 Å

PDB Description: crystal structure of pseudomonas aeruginosa isochorismate-pyruvate lyase k42a mutant in complex with salicylate and pyruvate
PDB Compounds: (B:) Salicylate biosynthesis protein pchB

SCOPe Domain Sequences for d3hgxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hgxb_ a.130.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfaaseaaipapervaamlpe
rarwaeengldapfveglfaqiihwyiaeqikywrqtrg

SCOPe Domain Coordinates for d3hgxb_:

Click to download the PDB-style file with coordinates for d3hgxb_.
(The format of our PDB-style files is described here.)

Timeline for d3hgxb_: