Lineage for d3hgxa_ (3hgx A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 924951Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 924952Superfamily a.130.1: Chorismate mutase II [48600] (4 families) (S)
  5. 924953Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins)
    intertwined homodimer of 3-helical subunits
  6. 924973Protein automated matches [191058] (1 species)
    not a true protein
  7. 924974Species Pseudomonas aeruginosa [TaxId:287] [188941] (4 PDB entries)
  8. 924983Domain d3hgxa_: 3hgx A: [177563]
    automated match to d2h9ca1
    complexed with pyr, sal; mutant

Details for d3hgxa_

PDB Entry: 3hgx (more details), 2.5 Å

PDB Description: crystal structure of pseudomonas aeruginosa isochorismate-pyruvate lyase k42a mutant in complex with salicylate and pyruvate
PDB Compounds: (A:) Salicylate biosynthesis protein pchB

SCOPe Domain Sequences for d3hgxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hgxa_ a.130.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfaaseaaipapervaamlpe
rarwaeengldapfveglfaqiihwyiaeqikywrqtrg

SCOPe Domain Coordinates for d3hgxa_:

Click to download the PDB-style file with coordinates for d3hgxa_.
(The format of our PDB-style files is described here.)

Timeline for d3hgxa_: