SCOPe 2.01: Domain d3hgxa_: 3hgx A:

Lineage for d3hgxa_ (3hgx A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.130: Chorismate mutase II [48599] (1 superfamily)
   multihelical; core: 6 helices, bundle

4. Superfamily a.130.1: Chorismate mutase II [48600] (4 families)

5. Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins)
   intertwined homodimer of 3-helical subunits

6. Protein automated matches [191058] (1 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [188941] (4 PDB entries)

8. Domain d3hgxa_: 3hgx A: [177563]
   automated match to d2h9ca1
   complexed with pyr, sal; mutant

Details for d3hgxa_

PDB Entry: 3hgx, 2.5 Å

PDB Description: crystal structure of pseudomonas aeruginosa isochorismate-pyruvate lyase k42a mutant in complex with salicylate and pyruvate

PDB Compounds: (A:) Salicylate biosynthesis protein pchB

SCOPe Domain Sequences for d3hgxa_:

Sequence; same for both SEQRES and ATOM records:

>d3hgxa_ a.130.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfaaseaaipapervaamlpe
rarwaeengldapfveglfaqiihwyiaeqikywrqtrg

Timeline for d3hgxa_:

• d3hgxa_ is new in SCOPe 2.01-stable
  
• d3hgxa_ appears in SCOPe 2.02
  
• d3hgxa_ appears in the current release, SCOPe 2.08