![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.130: Chorismate mutase II [48599] (1 superfamily) multihelical; core: 6 helices, bundle |
![]() | Superfamily a.130.1: Chorismate mutase II [48600] (5 families) ![]() |
![]() | Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins) intertwined homodimer of 3-helical subunits |
![]() | Protein automated matches [191058] (2 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [188941] (4 PDB entries) |
![]() | Domain d3hgxa_: 3hgx A: [177563] automated match to d2h9ca1 complexed with pyr, sal; mutant |
PDB Entry: 3hgx (more details), 2.5 Å
SCOPe Domain Sequences for d3hgxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hgxa_ a.130.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} mktpedctgladireaidridldivqalgrrmdyvkaasrfaaseaaipapervaamlpe rarwaeengldapfveglfaqiihwyiaeqikywrqtrg
Timeline for d3hgxa_: