SCOPe 2.02: Domain d3hgwd_: 3hgw D:

Lineage for d3hgwd_ (3hgw D:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.130: Chorismate mutase II [48599] (1 superfamily)
   multihelical; core: 6 helices, bundle

4. Superfamily a.130.1: Chorismate mutase II [48600] (4 families)

5. Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins)
   intertwined homodimer of 3-helical subunits

6. Protein automated matches [191058] (1 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [188941] (4 PDB entries)

8. Domain d3hgwd_: 3hgw D: [177562]
   automated match to d2h9ca1
   complexed with ca; mutant

Details for d3hgwd_

PDB Entry: 3hgw, 2.25 Å

PDB Description: apo structure of pseudomonas aeruginosa isochorismate-pyruvate lyase i87t mutant

PDB Compounds: (D:) Salicylate biosynthesis protein pchB

SCOPe Domain Sequences for d3hgwd_:

Sequence; same for both SEQRES and ATOM records:

>d3hgwd_ a.130.1.1 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlper
arwaeengldapfveglfaqiihwytaeqikywrqtr

Timeline for d3hgwd_:

• d3hgwd_ first appeared in SCOPe 2.01
  
• d3hgwd_ appears in SCOPe 2.03
  
• d3hgwd_ appears in the current release, SCOPe 2.08